Modified calcitonin
OwnerJesus Zurdo, Christopher Martin Dobsoninventors
Life of this patent
Estimating the term…
Abstract
Bioactive peptides are modified to have an increased solubility or reduced tendency to aggregate compared to the wild type modified peptide. In particular modified human calcitonin comprises a peptide having at least 70% identity to SEQ ID NO: 1 and being modified such that the tendency of the modified peptide to aggregate is reduced compared to unmodified human calcitonin.
Claims12
Modified human calcitonin, comprising a peptide having at least 70% identity to SEQ ID No 1 and being modified such that the tendency of the modified peptide to aggregate is reduced compared to unmodified human calcitonin.
Modified calcitonin according to any one of the preceding claims, wherein the peptide is unmodified compared to human calcitonin within the 5 N-terminal amino acids.
Modified calcitonin according to any one of the preceding claims, wherein the peptide is unmodified compared to human calcitonin within the 10 N-terminal amino acids.
Modified calcitonin according to any one of the preceding claims, wherein the peptide is unmodified compared to human calcitonin within the 5 C-terminal amino acids.
Modified calcitonin according to any one of the preceding claims, wherein the peptide is unmodified compared to human calcitonin within the 10 C-terminal amino acids.
Modified calcitonin according to any one of the preceding claims, wherein the peptide is selected from
- 7 CGNLSTCMLGKLTQELNKLHTFPQTAIGVGAP, CGNLSTCMLGKLTQELRKLHTFPQTAIGVGAP, CGNLSTCMLGKLTQELLKLHTFPQTAIGVGAP, CGNLSTCMLGKLTQELLKLLTFPQTAIGVGAP, or CGNLSTCMLGKLTQELLKLLTFPRTAIGVGAP.
A pharmaceutical composition comprising a modified peptide according to any one of the preceding claims and a pharmaceutically acceptable carrier.
A pharmaceutical composition or a modified peptide according to any one of the preceding claims for use in the treatment of paget's disease, hypercalcaemia or osteoporosis.
Dependencies are inferred from the claim text.