Loading patent…
OwnerRenuka Pillutla, Renee Brissette +7inventors
InventorsRenuka Pillutla, Renee Brissette, Arthur J. Blume, Lauge Schaffer, Jakob Brandt, Neil I. Goldstein, Jane Spetzler, Soren Ostergaard, Per Hertz Hansen
Estimating the term…
Peptide sequences capable of binding to insulin and/or insulin-like growth factor receptors with either agonist or antagonist activity and identified from various peptide libraries are disclosed. This invention also identifies at least two different binding sites, which are present on insulin and insulin-like growth factor receptors, and which selectively bind the peptides of this invention. As agonists, certain of the peptides of this invention may be useful for development as therapeutics to supplement or replace endogenous peptide hormones. The antagonists may also be developed as therapeutics.
A method of decreasing insulin receptor activity in mammalian cells comprising administering to said cells an amino acid sequence in an amount sufficient to decrease insulin activity, wherein the amino acid sequence comprises a subsequence that comprises a sequence that binds to Site 1 of insulin receptor and a subsequence that comprises a sequence that binds to Site 2 of insulin receptor, and wherein the subsequences are linked C-terminus to N-terminus and the subsequences are oriented Site 1 to Site 2, with the proviso that the amino acid sequence is not insulin, insulin-like growth factor, or fragments thereof.
A method of increasing insulin receptor activity in mammalian cells comprising administering to said cells an amino acid sequence in an amount sufficient to increase insulin activity, wherein the amino acid sequence comprises a subsequence that comprises a sequence that binds to Site 1 of insulin receptor and a subsequence that comprises a sequence that binds to Site 2 of insulin receptor, and wherein the subsequences are linked C-terminus to N-terminus and the subsequences are oriented Site 2 to Site 1, with the proviso that the amino acid sequence is not insulin, insulin-like growth factor, or fragments thereof.
A method of increasing insulin receptor activity in mammalian cells comprising administering to said cells an amino acid sequence in an amount sufficient to increase insulin activity, wherein the amino acid sequence comprises a plurality of subsequences that each comprise a sequence that binds to Site 1 of insulin receptor, with the proviso that the amino acid sequence is not insulin, insulin-like growth factor, or fragments thereof.
A method of increasing insulin receptor activity in mammalian cells comprising administering to said cells an amino acid sequence in an amount sufficient to increase insulin activity, wherein the amino acid sequence comprises a subsequence that comprises a sequence that binds to Site 1 of insulin receptor and a subsequence that comprises a sequence that binds to Site 2 of insulin receptor, wherein the subsequences are linked C-terminus to C-terminus or N-terminus to N-terminus, with the proviso that the amino acid sequence is not insulin, insulin-like growth factor, or fragments thereof.
An amino acid sequence that is an insulin receptor agonist, which comprises a subsequence that comprises a sequence that binds to Site 1 of the insulin receptor and a subsequence that comprises a sequence that binds to Site 2 of the insulin receptor, wherein the subsequences are linked C-terminus to N-terminus and the subsequences are oriented Site 2 to Site 1, with the proviso that the amino acid sequence is not insulin, insulin-like growth factor, or fragments thereof.
An amino acid sequence that is an insulin receptor agonist, which comprises a plurality of subsequences that each comprise a sequence that binds to Site 1 of insulin receptor, with the proviso that the amino acid sequence is not insulin, insulin-like growth factor, or fragments thereof.
An amino acid sequence that is an insulin receptor agonist, which comprises a subsequence that comprises a sequence that binds to Site 1 of insulin receptor and a subsequence that comprises a sequence that binds to Site 2 of insulin receptor, wherein the subsequences are linked C-terminus to C-terminus or N-terminus to N-terminus, with the proviso that the amino acid sequence is not insulin, insulin-like growth factor, or fragments thereof.
An amino acid sequence that is an insulin receptor antagonist, which comprises a subsequence that comprises a sequence that binds to Site 1 of insulin receptor and a subsequence that comprises a sequence that binds to Site 2 of insulin receptor, wherein the subsequences are linked C-terminus to N-terminus and the subsequences are oriented Site 1 to Site 2, with the proviso that the amino acid sequence is not insulin, insulin-like growth factor, or fragments thereof.
A method of increasing insulin receptor activity in mammalian cells comprising administering to said cells an amino acid sequence comprising a sequence selected from the group consisting of SLEEEWAQVECEVYGRGCPSGSLDESFYDWFERQLG (S519;
An amino acid sequence that is an insulin receptor agonist, which comprises a sequence selected from the group consisting of SLEEEWAQVECEVYGRGCPSGSLDESFYDWFERQLG (S519;
A method of increasing insulin-like growth factor receptor activity in mammalian cells comprising administering to said cells an amino acid sequence in an amount sufficient to increase insulin-like growth factor activity, wherein the amino acid sequence comprises a subsequence that comprises a sequence that binds to Site 1 of insulin-like growth factor receptor and a subsequence that comprises a sequence that binds to Site 2 of insulin-like growth factor receptor, and wherein the subsequences are linked C-terminus to N-terminus and the subsequences are oriented Site 2 to Site 1, with the proviso that the amino acid sequence is not insulin, insulin-like growth factor, or fragments thereof.
An amino acid sequence that is an insulin-like growth factor receptor agonist, which comprises a subsequence that comprises a sequence that binds to Site 1 of the insulin-like growth factor receptor and a subsequence that comprises a sequence that binds to Site 2 of the insulin-like growth factor receptor, wherein the subsequences are linked C-terminus to N-terminus and the subsequences are oriented Site 2 to Site 1, with the proviso that the amino acid sequence is not insulin, insulin-like growth factor, or fragments thereof.
An amino acid sequence that binds to insulin-like growth factor receptor, which comprises a sequence selected from the group consisting of a sequence that binds to Site 1 of the insulin-like growth factor receptor and a sequence that binds to Site 2 of the insulin-like growth factor receptor, with the proviso that the amino acid sequence is not insulin, insulin-like growth factor, or fragments thereof.
Dependencies are inferred from the claim text.