Novel peptides for use in treatment of T-cell mediated cartilage destruction in autoimmune diseases
AssigneeAkzo Nobel N.V.
InventorsGijsbertus Franciscus Maria Verheijden, Anna Maria Helena Boots
Life of this patent
Estimating the term…
Abstract
The invention relates to the use of novel peptides in a peptide-induced tolerance therapy for the induction of tolerance to autoaggressive T cells associated with T-cell mediated articular cartilage destruction in autoimmune diseases, more specifically arthritis. The invention furthermore embraces pharmaceutical compositions comprising said peptides and a diagnostic method for the detection of autoreactive T cells in a test sample, said T cells being associated with T-cell mediated articular cartilage destruction in autoimmune diseases and test kits to be used in said method.
Claims10
Peptide having 13-55 amino acid residues characterized in that said peptide comprizes the amino acid sequence
- AGWLR1DR2R3R4R5YPI
- in which
- R1=A, S
- R2=Q,R,G
- R3=T,S
- R4=V,L
- R5=&R, Q
- with the provision that the peptide is not SSAGWLADRSVRYPISKARPNXGG, NAGWLSDGSVQYPIREP, DAGWLADGHSVRYPISRPRKR, GGLDWCNAGWLSDGSVQYPIKPR or EQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCY.
Peptide having 13-55 amino acid residues characterized in that said peptide comprizes at least the amino acid sequence
- AGWLR1DR2R3LR5YPI
- in which
- R1=A, S
- R2=Q, R, G
- R3=T, S
- R5=R, Q
Peptide having 13-55 amino acid residues characterized in that said peptide comprizes at least one of the amino acid sequences AGWLADQTVRYPI, AGWLADRSVRYPI, AGWLSDGSVQYPI and AGWLADGSLRYPI.
Peptide consisting of one of the amino acid sequences AGWLADQTVRYPI, AGWLADRSVRYPI, AGWLSDGSVQYPI and AGWLADGSLRYPL
Peptide having 13-55 amino acid residues and comprizing the amino acid sequence
- AGWLR1DR2R3R4R5YPI
- in which R1=A, S, R2=Q, R, G, R3=T, S, R4=V, L, and R5=R, Q, for use as a medicament.
Pharmaceutical preparation comprizing a peptide having 13-55 amino acid residues, said peptide comprizing the amino acid sequence
- AGWLR1DR2R3R4R5YPI
- in which
- R1=A, S, R2=Q, R, G, R3=T, S, R4=V, L, and R5=R, Q, and a pharmaceutical acceptable carrier.
Pharmaceutical preparation comprizing a peptide having 13-55 amino acid residues, said peptide comprizing the amino acid sequence
- AGWLR1DR2R3LR5YPI
- in which R1=A, S, R2=Q, R, G, R3=T, S and R5=R, Q, and a pharmaceutical acceptable carrier.
Pharmaceutical preparation comprizing a peptide having 13-55 amino acid residues, said peptide comprizing at least one of the amino acid sequences AGWLADQTVRYPI, AGWLADRSVRYPI, AGWLSDGSVQYPI and AGWLADGSLRYPI.
Pharmaceutical preparation comprizing at least one of the peptides. AGWLADQTVRYPI, AGWLADRSVRYPI, AGWLADGSLRYPI and AGWLSDGSVQYPI and a pharmaceutical acceptable carrier
Use of a peptide having 13-55 amino acid residues, said peptide comprizing the amino acid sequence
- AGWLR1DR2R3R4R5YPI
- in which R1=A, S, R2=Q, R G, R3=T, S, R4=V, L, and R5=R, Q, for the manufacture of a pharmaceutical preparation for use in a peptide-induced tolerance therapy for the induction of tolarance to autoaggressive T cells associated with Tell mediated articular cartilage destruction in autoimmune diseases.
Dependencies are inferred from the claim text.