Loading patent…
OwnerGerald B. Price, Maria Zannis-Hadjopoulos +2inventors
InventorsGerald B. Price, Maria Zannis-Hadjopoulos, Torsten O. Nielsen, Nandini H. Cossons
Estimating the term…
The present invention relates to a human or mammalian DNA replication origin consensus sequence which consists of a sequence selected from the group consisting of CCTMDAWKSGBYTSMAAWYWBCMYTTRSCAAATTCC (SEQ ID NO: 1); and AWMTWAAKRAWRWWKKDAVWWGAKRWWKWVWHRASSACMDWKAAKTWKGGWTWARRYWKGRKMWWTWKAWSDATAKWWWKDAKWKMWRKTT (SEQ ID NO: 4). A method for the control of initiation of mammalian DNA replication which comprises the steps of: a) inserting a consensus sequence coding for a sequence of the present invention together with a DNA fragment to form a vector capable of expression of the DNA fragment; b) introducing the vector of step a) into mammalian cells in vitro.
A human or mammalian DNA replication origin consensus sequence which consists of a sequence selected from the group consisting of:
A protein which binds double-stranded DNA, which protein is isolated from HeLa cells and comprises about 150 kDa and two subunits of about 86 and 70 kDa in a glycerol gradient.
Dependencies are inferred from the claim text.