Back to results
US 12,760,079 B2Granted
CNP variants and conjugates thereof
AssigneeBiomarin Pharmaceutical Inc.
InventorsDaniel J. Wendt, Geoffrey Berguig, Karol Estrada, Jonathan LeBowitz, Jason Alan Moss
Life of this patent
Estimating the term…
Abstract
The present disclosure, relates, in general, to stable variants of C-type natriuretic peptide (CNP) and uses thereof to treat bone-related disorders.
Claims2
A peptide consisting of the amino acid sequence
- PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (SEQ ID NO:
- 1);
- and an AEEA-AEEA-γGlu-C18DA structure complexed via a linker to the lysine residue (K) at position 27,
- wherein the AEEA-AEEA-γGlu-C18DA structure and linker together has the structure:
- and represents a point of attachment to the lysine residue.
2 more elements
Dependencies are inferred from the claim text.