Back to results
US 12,735,453 B2Granted
Delivery peptides and methods of using the same
AssigneesThe National Institute for Biotechnology In the Negev Ltd., B. G. Negev Technologies and Applications Ltd.
InventorsIsam Khalaila, Amir Sagi, Shany Cohen
Life of this patent
Estimating the term…
Abstract
The present invention is directed to a peptide, and methods of using the same such as in the delivery of an agent into a cell, or modification of a cell.
Claims7
A chimera comprising a peptide comprising the amino acid sequence of KHKHKHKHKHKHKHKHKHCDKNIIKPAYGSYKYVEAHQESVLRK (SEQ ID NO:
- 24) directly or indirectly bound to a double stranded RNA (dsRNA) molecule, wherein the molar ratio of dsRNA:peptide is 1:5 to 1:20 therefor.
A chimera comprising a first peptide comprising the amino acid sequence:
- KHKHKHKHKHKHKHKHKHCDKNIIKPAYGSYKYVEAHQESVLRK (SEQ ID NO:
- 24) directly or indirectly bound to an agent selected from the group consisting of:
- polynucleotide, a second peptide, a small molecule, or any combination thereof.
Dependencies are inferred from the claim text.