Kits for preparing and delivering purified corticotropin
AssigneeANI Pharmaceuticals, Inc.
InventorsEdward M. DeSimone, III, Weijun Cheng, Zachary Holcomb
Life of this patent
Estimating the term…
Abstract
A kit and sterile preparation of purified corticotropin and methods relating thereto in which the preparation includes corticotropin extracted from a whole porcine pituitary gland including both anterior and posterior portions, and having proteins or peptides having a molecular weight higher than 4.6 kDa removed. Methods of manufacturing, testing, increasing stability, storage, and use of the purified corticotropin are also provided.
Claims18
A vial containing a sterile preparation of purified corticotropin, wherein the sterile preparation comprises 80 USP units per mL of the purified corticotropin, gelatin, and water for injection (WFI), wherein the purified corticotropin comprises a polypeptide having an amino acid sequence of SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF (SEQ ID NO:
- 1), and wherein the vial is not terminally sterilized.
Dependencies are inferred from the claim text.