JNK3 inhibitory peptides
AssigneesUniversita' Degli Studi Di Milano, Universita' Degli Studi Di Roma "Tor Vergata", Universita' Politecnica Delle Marche
InventorsTiziana Borsello, Mattia Falconi, Daniele Di Marino
Life of this patent
Estimating the term…
Abstract
The subject of the present invention is a peptide, natural or synthetic, which comprises an amino acid sequence that has at least 80% sequence identity with the sequence SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYKCPVAQLE (SEQ ID NO: 1). A further object of the present invention is said peptide which has at least 80% sequence identity with the sequence SEQ ID NO: 1 which is a JNK3 inhibitor for use in the prevention and/or treatment of neurodegenerative or neurodevelopmental diseases.
Claims10
A peptide, natural or synthetic, comprising an amino acid sequence that has at least 80% sequence identity with the sequence
- (SEQ ID NO:
- 1)
- SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYK
- CPVAQLE.
Dependencies are inferred from the claim text.