Back to results
US 12,686,726 B2Granted
Anti-MUC1 compositions and methods of use
AssigneePoseida Therapeutics, Inc.
InventorsEric M. Ostertag, Devon Shedlock
Life of this patent
Estimating the term…
Abstract
Disclosed are antibodies against MUC1, MUC1-CAR compositions and methods for use of these antibodies and compositions to target a MUC1 protein, wherein a cell expressing the MUC1 protein may be targeted and killed by, for instance, a cytotoxic T cell.
Claims34
A chimeric antigen receptor (CAR) comprising
- (a) an ectodomain comprising an antigen recognition region, wherein the antigen recognition region comprises at least one anti-MUC1 single chain variable fragment (scFv) comprising a heavy chain variable region comprising the amino acid sequence of
- QVQLVQSGAEVKKPGSSVKVSCKTSGYAFSNFWMNWVRQAPGOGLEWIGQIYPGDGDTNYNAKFKGRVTLTADKSTSTAYMELSSLRSEDTAVYFCARSYYRSAWFAYWGOGTLVTVSS (SEQ ID NO:4);
- and
- a light chain variable region comprising the amino acid sequence of
- EILLTOSPDFQSVTPKEKVTFTCRASQSIGTSIHWYQQKPNQSPKLLIKYASESISGVPSRFSGSGSGTDFTLTINSLESEDIATYYCQQSNNWPLTFGOGTKLEIK (SEQ ID NO:9), wherein the scFv comprises a linker between the heavy chain variable region and the light chain variable region;
- (b) a transmembrane domain, and
- (c) an endodomain comprising at least one signal transduction domain.
4 more elements
Dependencies are inferred from the claim text.