US 12,533,444 B2Granted

Mitigation of peri-implantitis by design and stability of bifunctional peptides with antimicrobial properties

AssigneesUniversity of Kansas, University of Southern California

InventorsCandan Tamerler-Behar, Emily Wisdom, Malcolm Snead

Life of this patent

Estimating the term…

Described herein is a bifunctional peptide, compositions comprising the same, and methods useful for treatment of peri-implant disease.

Dependent claims

A bifunctional peptide of amino acid sequence

(SEQ ID NO:
1)
RPRENRGRERGLGSGGGKWKLWKKIEKWGQGIGAVLKWLTTW
or one or both of a pharmaceutically acceptable salt thereof and a solvate thereof.

1 more element

Dependencies are inferred from the claim text.

A61L 27/54
Materials characterised by their function or physical properties , e.g. injectable or lubricating compositions, shape-memory materials, surface…:…
A61K 6/58
Preparations specially adapted for dental root treatment: specially adapted for dental implants
A61L 27/06
Metals or alloys: titanium or titanium alloys
A61L 27/227
Polypeptides or derivatives thereof , e.g. degradation products: other specific proteins or polypeptides not covered by A61L27/222, A61L27/225 or…

From the US filing history. Foreign family members aren’t listed.

Loading patent…