MIR-145 micelles for mitigating atherosclerosis
AssigneeUniversity of Southern California
InventorsEun Ji Paige Chung Yoo, Christopher Yan Hoi Poon, Deborah Darong Chin
Life of this patent
Estimating the term…
Abstract
A drug delivery system includes a plurality of nanoparticles wherein each nanoparticle includes a targeting peptide conjugated thereto that targets atherosclerotic plaque and a therapeutic agent conjugated thereto for treating atherosclerotic plaque. Alternatively, a drug delivery system includes a plurality of micelles wherein each micelle includes a targeting peptide conjugated thereto that targets atherosclerotic plaque and a drug incorporated into the core of the micelle or conjugated to the hydrophobic tail of the amphiphiles. A method for treating atherosclerosis in a subject is also provided.
Claims38
A drug delivery system comprising:
- a plurality of nanoparticles, wherein each nanoparticle includes a targeting peptide conjugated thereto that targets atherosclerotic plaque, and a therapeutic agent conjugated thereto for treating atherosclerotic plaque, wherein the therapeutic agent includes a component selected from the group consisting of miR-145 and therapeutically effective fragments thereof and wherein the targeting peptide includes a component selected from the group consisting of MCP-1 having a sequence having CYNFTNRKISVQRLASYRRITSSK (SEQ ID NO:
- 10), a VLA-4 peptide having sequence CVHPKQHR (SEQ ID NO:
- 3), a fibrin-targeting peptide having sequence CREKA (SEQ ID NO:
- 7), a collagenase-targeting peptide having sequence CVPMSMRGG (SEQ ID NO:
- 8), a collagenase-targeting peptide having sequence CVPMSMCYNFTNRKISVQRLASYRRITSSKRGG (SEQ ID NO:
- 4), and a hydroxyapatitie-targeting peptide having sequence SVSVGMKPSPRP SEQ ID NO:
- 9).
A drug delivery system comprising:
- a plurality of nanoparticles, wherein each nanoparticle includes a statin, a targeting peptide conjugated thereto that targets atherosclerotic plaque, and a therapeutic agent conjugated thereto for treating atherosclerotic plaque, wherein the therapeutic agent includes a component selected from the group consisting of miR-145 and therapeutically effective fragments thereof and wherein the targeting peptide includes a component selected from the group consisting of MCP-1 having a sequence having CYNFTNRKISVQRLASYRRITSSK (SEQ ID NO:
- 10), a VLA-4 peptide having sequence CVHPKQHR (SEQ ID NO:
- 3), a fibrin-targeting peptide having sequence CREKA (SEQ ID NO:
- 7), a collagenase-targeting peptide having sequence CVPMSMRGG (SEQ ID NO:
- 8), a collagenase-targeting peptide having sequence CVPMSMCYNFTNRKISVQRLASYRRITSSKRGG (SEQ ID NO:
- 4), and a hydroxyapatitie-targeting peptide having sequence SVSVGMKPSPRP SEQ ID NO:
- 9).
A drug delivery system comprising:
- a plurality of nanoparticles wherein each nanoparticle includes a statin, a therapeutic agent for treating atherosclerotic plaque conjugated thereto by a first DSPE-PEG(2000)-maleimide, and a targeting peptide that targets atherosclerotic plaque conjugated thereto by a second DSPE-PEG(2000)-maleimide, the therapeutic agent including miR-145 and the targeting peptide including a polypeptide having SEQ ID NO 1:
- YNFTNRKISVQRLASYRRITSSK or a fragment thereof that binds to MCP-1.
Dependencies are inferred from the claim text.