Treatment and detection of infection and disease associated with different fungal pathogens
AssigneeUniversity of Georgia Research Foundation, Inc.
InventorsKaren A. Norris, Whitney Rabacal, Emily Rayens
Life of this patent
Estimating the term…
Abstract
Described are immunogenic compositions comprising a non-naturally occurring pan-fungal Kex peptide, and methods of using such compositions for the treatment or prevention of infection and/or diseases associated with fungal pathogens (e.g., Pneumocystis, Aspergillus, Candida, or Cryptococcus) in the subject. Also provided are compositions and kits for detecting or quantifying the presence of antibodies directed against a non-naturally occurring pan-fungal Kex peptide in a subject.
Claims15
A method of eliciting an immune response in a subject, the method comprising administering to the subject an immunogenic composition comprising an effective amount of an immunogenic peptide having at least about 95% or more amino acid sequence identity to PDDGKTMEGPDILVLRAFINGVQNGRDGKGSIYVFASGNGGGFEDNCNFDGYTNSIYSIT VGAIDRKGLHPSYSEACSAQLVVTYSSGSG (Pan-fungal peptide 2) as set forth in SEQ ID NO:
- 2, or a polynucleotide encoding the peptide, and a pharmaceutically acceptable carrier or excipient.
A method of treating or protecting a subject against a fungal infection, the method comprising administering to the subject an immunogenic composition comprising an effective amount of an immunogenic peptide having at least about 95% or more amino acid sequence identity to PDDGKTMEGPDILVLRAFINGVQNGRDGKGSIYVFASGNGGGFEDNCNFDGYTNSIYSIT VGAIDRKGLHPSYSEACSAQLVVTYSSGSG (Pan-fungal peptide 2) as set forth in SEQ ID NO:
- 2 or a polynucleotide encoding the peptide, and a pharmaceutically acceptable carrier or excipient.
A method of treating or protecting a subject against a fungal infection, the method comprising administering to the subject an immunogenic composition comprising an effective amount of an immunogenic peptide having at least about 95% or more amino acid sequence identity to PDDGKTMEGPDILVLRAFINGVQNGRDGKGSIYVFASGNGGGFEDNCNFDGYTNSIYSIT VGAIDRKGLHPSYSEACSAQLVVTYSSGSG (Pan-fungal peptide 2) as set forth in SEQ ID NO:
- 2, or a polynucleotide encoding the peptide, and a pharmaceutically acceptable carrier or excipient;
- wherein the immunogenic composition elicits in the subject the production of antiserum comprising isolatable antibodies that specifically react with Pan-fungal peptide 2 and with kexin peptides of one or more fungal pathogens selected from Aspergillus, Candida, Cryptococcus, or Pneumocystis fungal pathogens.
A method of eliciting an immune response in a subject, or treating or protecting a subject against a fungal infection, the method comprising:
- administering to the subject an immunogenic composition comprising an effective amount of an immunogenic peptide comprising or consisting of the amino acid sequence PDDGKTMEGPDILVLRAFINGVQNGRDGKGSIYVFASGNGGGFEDNCNFDGYTNSIYSIT VGAIDRKGLHPSYSEACSAQLVVTYSSGSG (Pan-fungal peptide 2) as set forth in SEQ ID NO:
- 2, or a polynucleotide encoding the peptide, and a pharmaceutically acceptable carrier or excipient.
A method of treating or protecting a subject against a fungal infection, the method comprising administering to the subject an immunogenic composition comprising an effective amount of an immunogenic peptide comprising or consisting of the amino acid sequence PDDGKTMEGPDILVLRAFINGVQNGRDGKGSIYVFASGNGGGFEDNCNFDGYTNSIYSIT VGAIDRKGLHPSYSEACSAQLVVTYSSGSG (Pan-fungal peptide 2) as set forth in SEQ ID NO:
- 2, or a polynucleotide encoding the peptide, and a pharmaceutically acceptable carrier or excipient;
- wherein the immunogenic composition elicits in the subject the production of antiserum comprising isolatable antibodies that specifically react with Pan-fungal peptide 2 and with kexin peptides of one or more fungal pathogens selected from Aspergillus, Candida, Cryptococcus, or Pneumocystis fungal pathogens.
Dependencies are inferred from the claim text.