Back to results
US 12,448,463 B2Granted
Antibodies for botulinum neurotoxins
AssigneeThe Regents of the University of California
InventorsJames D. Marks, Maria Consuelo Garcia Rodriguez
Life of this patent
Estimating the term…
Abstract
The present disclosure provides antibodies that specifically bind to botulinum neurotoxins (e.g., BoNT/A, BoNT/B, BoNT/C, BoNT/D, BoNT/E, BoNT/F, BoNT/G, etc.) and the epitopes bound by those antibodies. The antibodies and derivatives thereof that specifically bind to the neutralizing epitopes provided herein can be used to neutralize botulinum neurotoxin and are therefore also useful in the treatment of botulism.
Claims24
A composition comprising:
- a) a first isolated nucleic acid comprising a nucleotide sequence encoding a variable heavy chain (VH) polypeptide comprising:
- a VH CDR1 comprising the amino acid sequence of NYPMS (SEQ ID NO:
- 509),
- a VH CDR2 comprising the amino acid sequence of SLTASGDNTFYADSVKG (SEQ ID NO:
- 510),
- a VH CDR3 comprising the amino acid sequence of ALVGRYDISTGYYRPVMDS (SEQ ID NO:
- 511);
- and
- b) a second isolated nucleic acid comprising a nucleotide sequence encoding a variable light chain (VL) polypeptide comprising:
- a VL CDR1 comprising the amino acid sequence of RASQSVSSSYLA (SEQ ID NO:
- 512),
- a VL CDR2 comprising the amino acid sequence of GTSSRAT (SEQ ID NO:
- 513), and
- a VL CDR3 comprising the amino acid sequence of QQYNNWPLT (SEQ ID NO 514).
11 more elements
A composition comprising:
- a) a first isolated nucleic acid comprising a nucleotide sequence encoding an amino acid sequence of a variable heavy chain (VH) polypeptide comprising the amino acid sequence of
- (SEQ ID NO:
- 304)
- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYPMSWVRQAPGKGLEWVS
- SLTASGDNTFYADSVKGRFTISRDNSKNTLYLQMHSLRAEDTAVYYCAK
- ALVGRYDISTGYYRPVMDSWGQGTLVTVSS;
- and
- b) a second isolated nucleic acid comprising a nucleotide sequence encoding an amino acid sequence of a variable light chain (VL) polypeptide comprising the amino acid sequence of
- (SEQ ID NO:
- 334)
- EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQKKPDQAPRLLI
- YGTSSRATGVTDRFTGSGSGTDFTLTISRLEPEDFAVYYCQQYNNWPLT
- FGGGTKAEIKR.
10 more elements
Dependencies are inferred from the claim text.