Amino acid-specific binder and selectively identifying an amino acid
AssigneeGovernment of the United States of America, AS Represented By the Secretary of Commerce
InventorsJennifer A. Tullman, Zvi Kelman, John P. Marino
Life of this patent
Estimating the term…
Abstract
An amino acid-specific binder selectively binds to a binding amino acid. A binder complex selectively identifies the binding amino acid and includes an adjunct attached to the amino acid-specific binder. The adjunct includes a taggant, protein, substrate, or chemical modifier. Selectively identifying an N-terminal amino acid includes anchoring a C-terminal end; contacting an N-terminal amino acid of the anchored analyte with the binder complex; selectively binding when the N-terminal amino acid includes the binding amino acid; producing, by the taggant of the tagged complex, a taggant signal; detecting the taggant signal; and identifying the N-terminal amino acid based on the taggant signal.
Claims17
A binder complex for selectively identifying an amino acid, the binder complex comprising:
- an amino acid-specific binder;
- and
- an adjunct attached to the amino acid-specific binder,
- wherein the amino acid-specific binder binds selectively to a binding amino acid, and
- the amino acid-specific binder comprises an amino acid sequence that comprises:
- (Sequence ID No. 10)
- NLEKIKKLRNVIKEIKKDNIKEADEHEKKEREKETSAWKVILYNDDIHK
- FSYVTDVIVKVVGQISKAKAHTITVEAHSTGQALILSTWKSKAEKYCQE
- LQQNGLTVSIIHESQLKDKQKK.
A process for selectively identifying an N-terminal amino acid, the process comprising:
- providing an analyte comprising a protein, a peptide, an amino acid, or a combination comprising at least one of foregoing;
- contacting a C-terminal end of the analyte with an anchor;
- anchoring the C-terminal end to the anchor to form an anchored analyte;
- contacting an N-terminal amino acid of the anchored analyte with a binder complex, the binder complex comprising:
- an amino acid-specific binder;
- and
- a taggant attached to the amino acid-specific binder;
- selectively binding the amino acid-specific binder of the binder complex to the N-terminal amino acid of the anchored analyte when the N-terminal amino acid comprises a binding amino acid to form a tagged complex;
- subjecting the taggant of the tagged complex to a stimulus;
- producing, by the taggant of the tagged complex, a taggant signal in response to the stimulus;
- detecting the taggant signal;
- and
- identifying the N-terminal amino acid based on the taggant signal,
- wherein the amino acid-specific binder binds selectively to the binding amino acid, and
- the amino acid-specific binder comprises an amino acid sequence comprising:
- (Sequence ID No. 10)
- NLEKIKKLRNVIKEIKKDNIKEADEHEKKEREKETSAWKVILYNDDIHK
- FSYVTDVIVKVVGQISKAKAHTITVEAHSTGQALILSTWKSKAEKYCQE
- LQQNGLTVSIIHESQLKDKQKK.
A process for selectively isolating an analyte, the process comprising:
- contacting an amino acid-specific binder with an analyte comprising a protein, a peptide, an amino acid, or a combination comprising at least one of foregoing;
- selectively binding the amino acid-specific binder to the N-terminal amino acid of the analyte when the N-terminal amino acid comprises a binding amino acid to form an isolation complex;
- separating the isolation complex from a fluid in which the isolation complex is disposed to selectively isolating the analyte,
- wherein the amino acid-specific binder binds selectively to the binding amino acid, and
- the amino acid-specific binder comprises an amino acid sequence comprising:
- (Sequence ID No. 10)
- NLEKIKKLRNVIKEIKKDNIKEADEHEKKEREKETSAWKVILYNDDIHK
- FSYVTDVIVKVVGQISKAKAHTITVEAHSTGQALILSTWKSKAEKYCQE
- LQQNGLTVSIIHESQLKDKQKK.
Dependencies are inferred from the claim text.