Back to results
US 11,685,717 B2Granted
Polypeptide integrin antagonists
AssigneeThe General Hospital Corporation
InventorM. Amin Arnaout
Life of this patent
Estimating the term…
Abstract
The present application relates to polypeptides which are integrin antagonists. Methods of preparing the integrin antagonists and methods of treating diseases and disorders associated with abnormal levels and/or expression of one or more integrins are also provided.
Claims24
A polypeptide comprising a sequence having at least 99% sequence identity to the sequence of:
- (SEQ ID NO:
- 1)
- R1-SDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFT
- VPGSKSTATISGLKPGVDYTITVYAVTP(Har)GDWNEGGPISINYRT-
- R2;
- wherein:
- R1 is absent or selected from the group consisting of a histidine tag, the human Fc fragment of IgG comprising a C-terminal histidine tag, an intervening spacer sequence, or a combination thereof, and
- R2 is absent or GKKGK (SEQ ID NO:
- 6).
6 more elements
Dependencies are inferred from the claim text.