Back to results
US 11,572,548 B2Granted
Reaction mixture for synthesis of alpha1-2-fucosides
AssigneeThe Regents of the University of California
InventorsXi Chen, Chao Zhao, Hai Yu
Life of this patent
Estimating the term…
Abstract
α1-2-fucosyltransferases, and methods and compositions for making and using α1-2-fucosyltransferases, are described herein.
Claims21
A reaction mixture comprising:
- an α1-2-fucosyltransferase enzyme having at least 90% sequence identity to SEQ ID NO:1 (Te2FT), wherein the α1-2-fucosyltransferase enzyme comprises the sequences of GGLGNQMFQYA (SEQ ID NO:16), SLHIRRGDY (SEQ ID NO:17), VFSDDPQW (SEQ ID NO:18), and DMQLMSACRHHIIANSTFSWWGAWLNPRPDKVVIAPRHWF (SEQ ID NO:19);
- a bifunctional L-fucokinase/GDP-fucose pyrophosphorylase enzyme (FKP) having at least 90% sequence identity to SEQ ID NO:2;
- a fucose donor comprising a nucleotide and a fucosyl moiety, and
- a β1-3-galactoside acceptor, wherein the acceptor comprises an oligosaccharide or a polysaccharide;
- and
- wherein the reaction mixture produces an α1-2-fucosylated β1-3 linked galactoside comprising the oligosaccharide or polysaccharide.
3 more elements
A method of making an α1-2-fucosylated β1-3 linked galactoside, the method comprising incubating a reaction mixture comprising:
- an α1-2-fucosyltransferase enzyme having at least 90% sequence identity to SEQ ID NO:1 (Te2FT), wherein the α1-2-fucosyltransferase enzyme comprises the sequences of GGLGNQMFQYA (SEQ ID NO:16), SLHIRRGDY (SEQ ID NO:17), VFSDDPQW (SEQ ID NO:18), and DMQLMSACRHHIIANSTFSWWGAWLNPRPDKVVIAPRHWF (SEQ ID NO:19);
- a bifunctional L-fucokinase/GDP-fucose pyrophosphorylase enzyme (FKP) having at least 90% sequence identity to SEQ ID NO:2;
- a fucose donor comprising a nucleotide and a fucosyl moiety;
- and
- a β1-3-galactoside acceptor,
- under conditions suitable to form the α1-2-fucosylated β1-3 linked galactoside.
3 more elements
Dependencies are inferred from the claim text.