Designed ankyrin repeat proteins binding to hepatocyte growth factor
AssigneeMolecular Partners AG
InventorsGaby Tresch, Talitha Bakker, Douglas Phillips, Frieder W. Merz, Kaspar H. Binz
Life of this patent
Estimating the term…
Abstract
New designed ankyrin repeat proteins with binding specificity for HGF are described, as well as nucleic acids encoding such HGF binding proteins, pharmaceutical compositions comprising such proteins and the use of such proteins in the treatment of diseases.
Claims22
A recombinant protein comprising an ankyrin repeat domain, wherein said ankyrin repeat domain binds HGF, and wherein said ankyrin repeat domain comprises an ankyrin repeat module having an amino acid sequence selected from the group consisting of (1) SEQ ID NO:
- 18 to 20, and (2) sequences in which up to 3 amino acids in SEQ ID NO:
- 18 to 20 are exchanged by another amino acid.
A recombinant protein comprising an ankyrin repeat domain, wherein said ankyrin repeat domain binds to human HGF, and wherein said ankyrin repeat domain comprises an amino acid sequence with at least 92% amino acid sequence identity with any one of the ankyrin repeat domains of SEQ ID NOs:
- 37, 43, 48, 50 to 52, and 60, wherein G at position 1 and/or S at position 2 of said ankyrin repeat domains are optionally missing;
- and L at the second last position and/or N at the last position of said ankyrin repeat domains are optionally exchanged by A.
A recombinant protein comprising an ankyrin repeat domain, wherein said ankyrin repeat domain binds human HGF, and wherein said ankyrin repeat domain comprises an ankyrin repeat module having an amino acid sequence selected from the group consisting of
- (SEQ ID NO:
- 18)
- (1) KDRYGDTPLHLAADIGHLEIVEVLLKAGADVNA,
- wherein
- K at position 1 is optionally exchanged by Q, H, I, V;
- R at position 3 is optionally exchanged by A, T or N;
- Y at position 4 is optionally exchanged by F or W;
- D at position 6 is optionally exchanged by N;
- D at position 14 is optionally exchanged by S;
- I at position 15 is optionally exchanged by Y or A;
- and
- E at position 19 is optionally exchanged by K;
- (SEQ ID NO:
- 19)
- (2) EDYFGNTPLHLAASYGHLEIVEVLLKAGADVNA,
- wherein
- E at position 1 is optionally exchanged by D, F, A, or L;
- Y at position 3 is optionally exchanged by W, S, or V;
- F at position 4 is optionally exchanged by Y;
- N at position 6 is optionally exchanged by D;
- and
- Y at position 15 is optionally exchanged by M, L, S, or A;
- and
- (SEQ ID NO:
- 20)
- (3) KDDYGNTPLHLAANTGHLEIVEVLLKAGADVNA,
- wherein
- K at position 1 is optionally exchanged by M, D, L, Q, or V;
- D at position 3 is optionally exchanged by Y, or T;
- Y at position 4 is optionally exchanged A, or N;
- T at position 15 is optionally exchanged by S;
- H at position 17 is optionally exchanged by R;
- and
- E at position 19 is optionally exchanged by K.
Dependencies are inferred from the claim text.