Back to results
US 11,390,657 B2Granted
Peptide analogs
AssigneeAdepthera LLC
InventorSheau Yu Teddy Hsu
Life of this patent
Estimating the term…
Abstract
Analogs for CLR/RAMP receptor ligands are provided that have agonist, superagonist, antagonist, super-antagonist, or multiple receptor modulating activity. The analogs can be selective for one or more CLR/RAMP receptors, or can be pan-specific for multiple G protein-coupled receptors.
Claims1
A Multiple Receptor Ligand (MRL), comprising
- (D-Phe)CF(D-Trp)KTCT-miniPEG-K(Pal)VQKLAHQIYQFTDKDVAPRSKISPQGY-NH2 or a pharmaceutically acceptable salt thereof, wherein miniPEG is —NH(CH2CH2O)2CH2C(═O)— and Pal is palmitoyl.
Dependencies are inferred from the claim text.