# US 11,077,168 B2 · Use of an immunomodulatory protein in reducing damage caused by fine particulate matter

> Agents: this data is available as JSON from the patentgrep API and MCP server — see https://patentgrep.com/llms.txt

- Number: US 11,077,168 B2
- Document ID: US11077168B2
- Status: Granted
- Kind: B2
- Application number: 15/944,126
- Filed: 2018-04-03
- Published: 2019-10-03
- Granted: 2021-08-03
- Earliest claimed: 2018-04-03
- Assignees: Mycomagic Biotechnology Co., Ltd.
- Applicants: Mycomagic Biotechnology Co., Ltd
- Inventors: Ming Wei Chao
- Web page: https://patentgrep.com/patent/US11077168B2

## CPC

- A61K 38/16: Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof {(enzyme inhibitors A61K38/005)}
- A61K 9/0053: {Mouth and digestive tract, i.e. intraoral and peroral administration}
- A61P 25/28: for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
- C07K 14/375: from Basidiomycetes
- A61K: PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES (devices or methods specially adapted for bringing pharmaceutical products into particular physical or administering forms A61J3/00; chemical aspects of, or use of materials for deodorisation of air, for disinfection or sterilisation, or for bandages, dressings, absorbent pads or surgical articles A61L; soap compositions C11D)
- A61P: SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- C07K: PEPTIDES (peptides in foodstuffs A23; obtaining protein compositions for foodstuffs, working-up proteins for foodstuffs A23J; preparations for medicinal purposes A61K; peptides containing beta-lactam rings C07D; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, C07D; ergot alkaloids of the cyclic peptide type C07D519/02; macromolecular compounds having statistically distributed amino acid units in their molecules, i.e. when the preparation does not provide for a specific; but for a random sequence of the amino acid units, homopolyamides and block copolyamides derived from amino acids C08G69/00; macromolecular products derived from proteins C08H1/00; preparation of glue or gelatine C09H; single cell proteins, enzymes C12N; genetic engineering processes for obtaining peptides C12N15/00; compositions for measuring or testing processes involving enzymes C12Q; investigation or analysis of biological material G01N33/00)

## Abstract

The present invention relates to a new use of an immunomodulatory protein derived from Ganoderma or a recombinant or a composition thereof in reducing damage caused by fine particulate matter on embryos and offspring. Accordingly, the present invention suggests that the Ganoderma immunomodulatory protein administrated to pregnant animals can prevent neurological damages and reduce risk of disorders in embryos and offspring.

## Claims

### Claim 1

A method for reducing neurological damage to neurites of offspring of a pregnant subject caused by exposure of the pregnant subject to particulate matter, or enhancing working memory, memory function, spatial cognition and long-term memory in offspring of a pregnant subject, comprising administering an effective amount of an immunomodulatory protein derived from Ganoderma, or a recombinant or a composition thereof, to the pregnant subject exposed to particulate matter, wherein the immunomodulatory protein derived from Ganoderma, or a recombinant or a composition thereof comprises an amino acid sequence selected from the group consisting of the amino acid sequence of:
MSDTALIFTLAWNVKQLAFDYTPNWGRGRPSSFIDTVTFPTVLTDKAYTY RVVVSGKDLGVRPSYAVESDGSQKINFLEYNSGYGIADTNTIQVYVIDPD TGNNFIVAQWN (SEQ ID NO: 3) and the amino acid sequence of EAEAEFMSDTALIFTLAWNVKQLAFDYTPNWGRGRPSSFIDTVTFPTVLT DKAYTYRVVVSGKDLGVRPSYAVESDGSQKINFLEYNSGYGIADTNTIQV YVIDPDTGNNFIVAQWNYLEQKLISEEDLNSAVDHHHHHH-(SEQ ID NO: 4).

### Claim 2 (depends on 1)

The method of claim 1, wherein the neurological damage to neurites is a damage to memory function, long-term memory, short-term memory, working memory or spatial cognition.

### Claim 3 (depends on 1)

The method of claim 1, wherein the immunomodulatory protein of Ganoderma or a recombinant thereof comprises an amino acid sequence of SEQ ID NO:4.

### Claim 4 (depends on 1)

The method of claim 1, wherein the immunomodulatory protein is orally administered.

### Claim 5 (depends on 1)

The method of claim 1, wherein the effective amount of the immunomodulatory protein ranges from about 0.01 mg/kg to about 5 mg/kg.

### Claim 6 (depends on 1)

The method of claim 1, wherein the effective amount of the immunomodulatory protein ranges from about 0.1 mg/kg to about 3 mg/kg.

### Claim 7 (depends on 1)

The method of claim 1, wherein the immunomodulatory protein is derived from Ganoderma microsporum.

### Claim 8

A method for reducing neurological damage to neurites of offspring of a pregnant subject caused by exposure of the pregnant subject to particulate matter, or enhancing working memory, memory function, spatial cognition and long-term memory in offspring of a pregnant subject, comprising administering an effective amount of an immunomodulatory protein derived from Ganoderma, or a recombinant or a composition thereof, to the pregnant subject exposed to particulate matter, wherein the immunomodulatory protein derived from Ganoderma, or a recombinant or a composition thereof comprises an amino acid sequence selected from the group consisting of: (1) Leu-Ala-Trp-Asp-Val-Lys (LAWDVK) (SEQ ID NO: 5) and (2) Asn-Leu-Gly-Val-Lys-Pro-Ser-Tyr-Ala-Val (NLGVKPSYAV) (SEQ ID NO: 6).