Loading patent…
AssigneeThe Regents of the University of California
InventorsEliezer Masliah, Brian Spencer, Edward Rockenstein
Estimating the term…
In alternative embodiments, provided are compositions such as antibodies, e.g., single chain antibodies, that target 3-repeat (3R) Tau for the treatment of neurodegenerative disorders and taupathies such as Alzheimer's Disease (AD), Pick's Disease (PiD) and Fronto-temporal lobar degeneration (FTLD), or any disorder or condition associated with a 3R Tau accumulation, and methods for making and using them. In alternative embodiments, provided are brain-penetrating antibodies that specifically recognize 3R Tau, and methods of using them to treat, ameliorate, prevent or decrease the symptoms of neurodegenerative disorders including taupathies such as Alzheimer's Disease (AD), Pick's Disease (PiD) and Fronto-temporal lobar degeneration (FTLD), or any disorder or condition associated with a 3R Tau accumulation. Provided are methods for diagnosing a neurodegenerative disorder or a taupathy or any disorder or condition associated with a 3R Tau accumulation, and optionally the taupathy is Alzheimer's Disease, Pick's Disease or Fronto-temporal lobar degeneration.
A pharmaceutical composition, a nanoparticle, a particle, a liposome, a micelle, or an implant, comprising an antibody or single chain antibody fragment (scFV) that specifically targets, or specifically binds to, a 3-repeat (3R) Tau polypeptide and does not specifically recognize or bind to a 4-repeat (4R) Tau polypeptide, wherein the antibody or scFv comprises a VH domain MEQVNLRESGAEVKKPGASVKVSCKVSGYTFTGYY MHWVRQAPGQGLEWMGWINS NSGATKYAQKFQGRVTMTRDTSITT AYMELSSLRSDDTAVYYCARGARDGYGFDYW GQGTLVTVL (SEQ ID NO:
A recombinant or synthetic single chain antibody fragment (scFv) comprising SEQ ID NO:
Dependencies are inferred from the claim text.