Back to results
US 10,882,890 B2Granted
Bipartite molecules and uses thereof in treating diseases associated with abnormal protein aggregates
AssigneeAcademia Sinica
InventorsBenjamin Pang-Hsien Tu, Rita Py Chen, Joseph Jen-Tse Huang, Yijuang Chern, Yu-Song Jang, Xiang-Me Lai, Tai-Yan Liao, Te-Hsien Kung
Life of this patent
Estimating the term…
Abstract
Bipartite molecules comprising a peptide affinity moiety and at least one charged moiety and uses thereof in reducing formation of abnormal protein aggregate and treating diseases associated with such abnormal protein aggregate, including neurodegenerative disease characterized by formation of protein aggregates.
Claims4
A bipartite molecule, wherein the molecule is selected from the group consisting of:
- (a) a molecule comprising the amino acid sequence of RRRRRRRRGSNKGAIIGLM-PEI (SEQ ID NO:
- 4), wherein the C-terminal PEI is polyethylenimine;
- (b) a molecule comprising the amino acid sequence of YEVHHQKLVFFAEDDPGSNKGAIIGLMVGGVV-PEI (SEQ ID NO:
- 5), wherein the C-terminal PEI is polyethylenimine;
- (c) a molecule comprising the amino acid sequence of RRRRRRRRWDQQQQQQQQQQ (SEQ ID NO:
- 6);
- and
- (d) a molecule comprising the amino acid sequence of RRRRRRRRWDQQQQQQQQQQQQQQQ (SEQ ID NO:
- 7).
6 more elements
Dependencies are inferred from the claim text.