US 10,851,139 B2 · Antibacterial method

Abstract

The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis. E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.

Claims15

Dependent claims

A method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria,

wherein said bacteriocin is a peptide comprising an amino acid sequence selected from:
a) MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC (SEQ ID NO:1), and
b) a sequence with at least 70% sequence identity to sequence a),
wherein sequence b) comprises at least the consensus sequence KXXXGXXPWE, wherein X may be any amino acid, and
wherein said bacteria is vancomycin-resistant E. faecium;
and optionally said bacteria is subjected to a stress condition.

3 more elements

Dependencies are inferred from the claim text.

Facts

Application

16/469,757Filed 14 Dec 2017

Priority

GB 1621295.314 Dec 2016

Published

US 2019/0322705 A124 Oct 2019

Granted

1 Dec 2020

Term ends

Not estimatedThe source records don’t support an estimate.

Classification22 codes

A61K 38/164
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof: from bacteria
A01N 63/50
Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances…:…
A23B 2/05
Preservation of foods or foodstuffs, in general: by heating using irradiation or electric treatment
A23B 2/40
Preservation of foods or foodstuffs, in general: by heating loose unpacked materials

Antibacterial method

Life of this patent

Antibacterial method

Life of this patent

Abstract

Claims15