PDGF-B /PDGF-BB binding variants of heparan sulfates
AssigneeAgency for Science, Technology and Research
InventorsSimon Cool, Victor Nurcombe
Life of this patent
Estimating the term…
Abstract
Affinity purification of platelet-derived growth factor-binding heparan sulphate from porcine mucosa (HS6) is disclosed. Also disclosed is the use of HS6 in repair and regeneration of the skin for treating wounds, burns, ulcers and other skin injuries.
Claims22
A method of treating a disease, condition or injury to skin in a patient, the method comprising administration of a therapeutically effective amount of heparan sulphate HS6 to the patient leading to repair and/or regeneration of the skin, wherein the heparan sulphate HS6 is capable of binding a peptide or polypeptide having, or consisting of, the amino acid sequence RAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDK (SEQ ID NO:1);
- wherein following digestion with heparin lyases I, II, and III and then subjecting the resulting disaccharide fragments to HPLC analysis, the heparan sulphate HS6 has a disaccharide composition comprising:
- Disaccharide
- Normalised weight percentage
- ΔUA,2S-GlcNS,6S
- 12.9 ± 3.0
- ΔUA,2S-GlcNS
- 6.8 ± 2.0
- ΔUA-GlcNS,6S
- 11.7 ± 3.0
- ΔUA-GlcNS
- 24.5 ± 3.0
- ΔUA,2S-GlcNAc
- 0.5 ± 0.5
- ΔUA-GlcNAc,6S
- 12.1 ± 3.0
- ΔUA-GlcNAc
- 31.6 ± 3.0.
A method of treating a disease, condition or injury to skin in a patient, the method comprising surgically implanting a biocompatible implant or prosthesis, which implant or prosthesis comprises a biomaterial and heparan sulphate HS6, into tissue of the patient at or surrounding the site of the disease, condition or injury leading to repair and/or regeneration of the skin, wherein the heparan sulphate HS6 is capable of binding a peptide or polypeptide having, or consisting of, the amino acid sequence RAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDK (SEQ ID NO:1);
- wherein following digestion with heparin lyases I, II, and III and then subjecting the resulting disaccharide fragments to HPLC analysis, the heparan sulphate HS6 has a disaccharide composition comprising:
- Disaccharide
- Normalised weight percentage
- ΔUA,2S-GlcNS,6S
- 12.9 ± 0.5
- ΔUA,2S-GlcNS
- 6.8 ± 0.2
- ΔUA-GlcNS,6S
- 11.7 ± 0.5
- ΔUA-GlcNS
- 24.6 ± 1.5
- ΔUA,2S-GlcNAc
- 0.5 ± 0.2
- ΔUA-GlcNAc,6S
- 12.1 ± 0.5
- ΔUA-GlcNAc
- 31.6 ± 0.8.
Dependencies are inferred from the claim text.