# US 10,370,438 B2 · Histamine-releasing factor (HRF), HRF-receptor and methods of modulating inflammation

> Agents: this data is available as JSON from the patentgrep API and MCP server — see https://patentgrep.com/llms.txt

- Number: US 10,370,438 B2
- Document ID: US10370438B2
- Status: Granted
- Kind: B2
- Application number: 14/462,424
- Filed: 2014-08-18
- Published: 2015-02-05
- Granted: 2019-08-06
- Earliest claimed: 2010-03-31
- Assignees: La Jolla Institute for Allergy and Immunology
- Applicants: La Jolla Institute for Allergy and Immunology
- Inventors: Toshiaki Kawakami; Yuko Kawakami
- Web page: https://patentgrep.com/patent/US10370438B2

## CPC

- C07K 16/18: against material from animals or humans
- A61K 38/1709: {from mammals}
- A61K 39/3955: {against proteinaceous materials, e.g. enzymes, hormones, lymphokines}
- C07K 7/08: having 12 to 20 amino acids (gastrins C07K14/595; somatostatins C07K14/655; melanotropins C07K14/68)
- C07K 14/47: from mammals
- C07K 14/52: Cytokines; Lymphokines; Interferons
- A61K 2039/505: {comprising antibodies}
- C07K 2317/24: containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
- C07K 2317/76: Antagonist effect on antigen, e.g. neutralization or inhibition of binding
- C07K 2319/00: Fusion polypeptide
- G01N 2500/02: Screening involving studying the effect of compounds C on the interaction between interacting molecules A and B (e.g. A = enzyme and B = substrate for A, or A = receptor and B = ligand for the receptor)
- G01N 2800/24: Immunology or allergic disorders
- C07K: PEPTIDES (peptides in foodstuffs A23; obtaining protein compositions for foodstuffs, working-up proteins for foodstuffs A23J; preparations for medicinal purposes A61K; peptides containing beta-lactam rings C07D; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, C07D; ergot alkaloids of the cyclic peptide type C07D519/02; macromolecular compounds having statistically distributed amino acid units in their molecules, i.e. when the preparation does not provide for a specific; but for a random sequence of the amino acid units, homopolyamides and block copolyamides derived from amino acids C08G69/00; macromolecular products derived from proteins C08H1/00; preparation of glue or gelatine C09H; single cell proteins, enzymes C12N; genetic engineering processes for obtaining peptides C12N15/00; compositions for measuring or testing processes involving enzymes C12Q; investigation or analysis of biological material G01N33/00)
- A61K: PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES (devices or methods specially adapted for bringing pharmaceutical products into particular physical or administering forms A61J3/00; chemical aspects of, or use of materials for deodorisation of air, for disinfection or sterilisation, or for bandages, dressings, absorbent pads or surgical articles A61L; soap compositions C11D)
- G01N: INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES (measuring or testing apparatus or processes other than immunoassay, involving enzymes or microorganisms C12M, C12Q)

## Abstract

Methods of treating a food allergy, allergic reactions, hypersensitivity, inflammatory responses, inflammation are provided. In one method, histamine releasing factor (HRF)/translationally controlled tumor protein (TCTP) is contacted with a compound that inhibits or reduces binding of HRF/TCTP to an immunoglobulin in order to treat the food allergy, allergic reaction, hypersensitivity, inflammatory response, or inflammation. Methods of reducing or decreasing the probability, severity, frequency, duration or preventing a subject from having an acute or chronic food allergy, allergic reaction, hypersensitivity, an inflammatory response or inflammation, are also provided. In one method, histamine releasing factor (HRF)/translationally controlled tumor protein (TCTP) is contacted with a compound that inhibits or reduces binding of HRF/TCTP to an immunoglobulin in order to reduce or decrease the probability, severity, frequency, duration or prevent a subject from having an acute or chronic food allergy, allergic reaction, hypersensitivity, an inflammatory response or inflammation.

## Claims

### Claim 1

A method of treating an allergic reaction, hypersensitivity, an inflammatory response or inflammation in a subject, comprising administering to the subject a peptide inhibitor of histamine releasing factor (HRF)/translationally controlled tumor protein (TCTP) receptor interaction, said peptide inhibitor consisting of amino acids 1-19 or amino acids 79-142 of SEQ ID NO:3 thereby treating the allergic reaction, hypersensitivity, inflammatory response or inflammation.

### Claim 2 (depends on 1)

The method of claim 1, wherein the peptide inhibitor binds to an immunoglobulin.

### Claim 3 (depends on 1)

The method of claim 1, wherein the peptide inhibitor consists of MIIYRDLISHDEMFSDIYK (SEQ ID NO:1) or QETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQ FFIGENMNP (SEQ ID NO:2) sequence.

### Claim 4 (depends on 1)

The method of claim 1, wherein the treatment is sufficient to decrease, reduce, inhibit, suppress, limit, control or improve the probability, severity, frequency, or duration of one or more adverse symptoms, disorders, illnesses, pathologies, diseases, or complications caused by or associated with food allergy, allergic reaction, hypersensitivity, inflammatory response or inflammation.

### Claim 5 (depends on 1)

The method of claim 1, wherein the method reduces or inhibits progression, severity frequency, duration or probability of an adverse symptom of food allergy, allergic reaction, hypersensitivity, inflammatory response or inflammation.

### Claim 6 (depends on 5)

The method of claim 5, wherein the adverse symptom comprises shortness of breath (dyspnea), wheezing, stridor, coughing, airway remodeling, rapid breathing (tachypnea), prolonged expiration, runny nose, rapid or increased heart rate (tachycardia), rhonchous lung, over-inflation of the chest or chest-tightness, decreased lung capacity, an acute asthmatic episode, lung, airway or respiratory mucosum inflammation, or lung, airway or respiratory mucosum tissue damage.

### Claim 7 (depends on 1)

The method of claim 1, wherein the allergic reaction is selected from: Extrinsic or intrinsic bronchial asthma; Allergic rhinitis; Onchocercal dermatitis; Atopic dermatitis; eczema; rash; allergic urticaria (e.g. hives); allergic conjunctivitis; Drug reactions; Nodules, eosinophilia, rheumatism, dermatitis, and swelling (NERDS); esophageal and a gastrointestinal allergy.

### Claim 8 (depends on 1)

The method of claim 1, wherein the hypersensitivity, inflammatory response or inflammation comprises a respiratory disease or disorder.

### Claim 9 (depends on 8)

The method of claim 8, wherein the respiratory disease or disorder comprises asthma, allergic asthma, bronchiolitis or pleuritis.

### Claim 10 (depends on 8)

The method of claim 8, wherein the respiratory disease or disorder is selected from: Airway Obstruction, Apnea, Asbestosis, Atelectasis, Berylliosis, Bronchiectasis, Bronchiolitis, Bronchiolitis Obliterans Organizing Pneumonia, Bronchitis, Bronchopulmonary Dysplasia, Empyema, Pleural Empyema, Pleural Epiglottitis, Hemoptysis, Hypertension, Kartagener Syndrome, Meconium Aspiration, Pleural Effusion, Pleurisy, Pneumonia, Pneumothorax, Respiratory Distress Syndrome, Respiratory Hypersensitivity, Rhinoscleroma, Scimitar Syndrome, Severe Acute Respiratory Syndrome, Silicosis, Tracheal Stenosis, eosinophilic pleural effusions, Histiocytosis; chronic eosinophilic pneumonia; hypersensitivity pneumonitis; Allergic bronchopulmonary aspergillosis; Sarcoidosis; Idiopathic pulmonary fibrosis; pulmonary edema; pulmonary embolism; pulmonary emphysema; Pulmonary Hyperventilation; Pulmonary Alveolar Proteinosis; Chronic Obstructive Pulmonary Disease (COPD); Interstitial Lung Disease; allergic rhinoconjunctivitis; allergic conjunctivitis and Topical eosinophilia.