Back to results
US 10,328,144 B2Granted
Influenza virus vaccines and uses thereof
AssigneeJanssen Vaccines & Prevention B.V.
InventorsAntonietta Impagliazzo, Jan Willem Meijberg, Katarina Radosevic, Michelle Wagner, Zhaoqing Ding
Life of this patent
Estimating the term…
Abstract
Provided herein are influenza hemagglutinin stem domain polypeptides, methods for providing hemagglutinin stem domain polypeptides, compositions comprising the same, vaccines comprising the same and methods of their use, in particular in the detection, prevention and/or treatment of influenza.
Claims11
An influenza hemagglutinin stem domain polypeptide comprising the amino acid sequence:
- (SEQ ID NO:
- 146)
- DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLENGGGGKYVCSAKLRMV
- TGLRNX1PSX2QSQGLFGAIAGX3X4EGGWTGMVDGWYGYHHQNEQGSGYA
- ADQKSTQNAINGITNKVNSVIEKX5NTQX6TAX7GKEX8NKX9ERRMKQIED
- KIEEIESKIWCYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKE
- IGNGCFEFYHKCNDECMESVKNGTYDYPKYSEESKLNREKIDG,
- wherein X1 is an amino acid selected from the group consisting of E, I, K, V, A, and T;
- X2 is an amino acid selected from the group consisting of I, K, R, T, F, N, S and Y;
- X3 is an amino acid selected from the group consisting of D, F, V, Y, A, I, N, S, and T;
- X4 is an amino acid selected from the group consisting of I, K, R, T, E, G and V;
- X5 is an amino acid selected from the group consisting of, M, E, K, V, R, T;
- X6 is an amino acid selected from the group consisting of F, I, N, S, T, Y, H, and L;
- X7 is an amino acid selected from the group consisting of A, G, I, R, T, V, F, and S;
- X8 is an amino acid selected from the group consisting of F, I, N, S, T, Y, G, E, K, M and V;
- and
- X9 is an amino acid selected from the group consisting of H, I, L, N, R, and S.
14 more elements
Dependencies are inferred from the claim text.