GP120 immunogens and methods inducing neutralizing antibodies to human immunodeficiency virus
AssigneesDuke University, Children's Medical Center Corporation
InventorsBarton F. Haynes, Garnett Kelsoe, Stephen Harrison, Thomas B. Kepler
Life of this patent
Estimating the term…
Abstract
The present invention relates, in general, to an HIV-1 vaccine and, in particular, to a B cell lineage-based vaccination protocol.
Claims17
A method of inducing an immune response in a mammal comprising sequentially administering to said mammal a prime immunogen and a boost immunogen, wherein the prime immunogen comprises all the consecutive amino acids after signal peptide sequence MRVKETQMNWPNLWKWGTLILGLVIICSA in SEQ ID NO:
- 2 and wherein the boost immunogen comprises all the consecutive amino acids after signal peptide sequence MRVKGIRKNCQQHLWRWGTMLLGILMICSA in SEQ ID NO:
- 4.
A method of inducing an immune response in a mammal comprising sequentially administering to said mammal a prime immunogen and a boost immunogen, wherein the prime immunogen comprises all the consecutive amino acids after signal peptide sequence MRVKETQMNWPNLWKWGTLILGLVIICSA in SEQ ID NO:
- 2 and wherein the boost immunogen comprises all the consecutive amino acids after signal peptide sequence MRVKETQRSWPNLWKWGTLILGLVIMCNA in SEQ ID NO:
- 3.
A composition comprising an immunogen comprising all the consecutive amino acids after signal peptide sequence MRVKETQMNWPNLWKWGTLILGLVIICSA in SEQ ID NO:
- 2 and an immunogen comprising all the consecutive amino acids after signal peptide sequence MRVKETQRSWPNLWKWGTLILGLVIMCNA in SEQ ID NO:
- 3.
A method of inducing an immune response in a mammal comprising sequentially administering to said mammal a prime immunogen and a boost immunogen, wherein the prime immunogen comprises all the consecutive amino acids after signal peptide sequence MRVKETQMNWPNLWKWGTLILGLVIICSA in SEQ ID NO:
- 2 and wherein the boost immunogen comprises all the consecutive amino acids after signal peptide sequence MRVKGIRKNCQQHLWRWGTMLLGILMICSA in SEQ ID NO:
- 5.
Dependencies are inferred from the claim text.